Journal Article

An enigmatic new Loricariid (Actinopterygii:Siluriformes) from relictual upper reaches of Chapada Diamantina, Bahia, Brazil

Pereira, E.H.L., de A. Santos, A.C., de Pinna, M.C.C. and Reis, R.E.

Record Number:
6177
Year:
2019
Journal:
107
Pages:
597-605
Volume:
107
Abstract:
Parotocinclus adamanteus, new species, is described from a series of specimens collected in the upper portion of the Rio Paraguacu basin, a coastal river withintheChapadaDiamantinadomain,alargeplateauontheStateofBahiain northeasternBrazil.Thedescriptionofthisnewspeciesrepresentsthefirstrecordofamemberofthe Hypoptopomatinaefromthisrelictualarea.Thenewspeciesisdiagnosedfromother Parotocinclus by havingadistinct rostralborderformingafleshyintumescenceonthelateralportionofheadornamentedwithmoderately hypertrophiedodontodesinadultmales.Itisalsodiagnosedfromcongenersbyaremarkablesecondarysexual dimorphismintheshapeofthepelvicfin,inwhichthebranchedraysofmalesdecreaseinsize,resultinginapointed posteriorfinmargin(branchedpelvic-finraysinfemaleshaveapproximatelythesamesize,producingaroundposterior fin margin).Inaddition,thenewspeciescanbefurtherdistinguishedfromotherspeciesof Parotocinclus by lackinga rostral platecoveringthetipofthemesethmoidanteriorly,bylackingabdominalplatesbetweenthepectoralgirdle and theanus,byhavingnumerouspremaxillaryteeth(45–61),andbyhavingashortandmesiallyexpandedventral portion ofthecheekcanalplate.Recentphylogeneticanalysisindicatesthat Parotocinclusadamanteus, new species,is closely relatedto P. jequi, P. prata, and P. robustus.
Times Cited:
2
Related Records:
Trajano, E. (1993)
Considerations about systematics and the evolution of behavior in Siluriform cave fishes
Mendes, L.F. (1995)
Observations on the ecology and behaviour of a new species of troglobitic catfish from northeastern Brazil (Siluriformes, Pimelodidae)
Trajano, E. and Menna-Barreto, L. (1995)
Locomotor activity pattern of Brazilian cave catfishes under constant darkness (Siluriformes, Pimelodidae)
Trajano, E. (1997)
Food and reproduction of Trichomycterus itacarambiensis, a cave catfish from south-eastern Brazil
Reis, R.E. (1998)
Anatomy and phylogenetic analysis of the neotropical callichthyid catfishes (Ostariophysi, Siluriformes)
Trajano, E. and Bockmann, F.A. (2000)
Ecology and behaviour of a new cave catfish of the genus Taunayia from north-eastern Brazil (Siluriformes: Pimelodidae)
Britto, M. (2003)
Phylogeny of the subfamily Corydoradinae Hoedeman, 1952 (Siluriformes: Callichthyidae), with a definition of its genera
Britto, M.R., Lima, F.C.T. and Santos, A.C.A. (2005)
A new Aspidoras (Siluriformes: Callichthyidae) from rio Paraguaçu basin, Chapada Diamantina, Bahia, Brazil
Britto, M.R., Lima, F.C.T. and Santos, A.C.A. (2005)
A new Aspidoras (Siluriformes: Callichthyidae) from rio Paraguaçu basin, Chapada Diamantina, Bahia, Brazil
Ribeiro, AC (2006)
Tectonic history and the biogeography of freshwater fishes from the coastal drainages of eastern Brazil: an example of faunal evolution associated with a divergent continental margin
Bockmann, F.A. and Castro, R.M.C. (2010)
The blind catfishes from the caves of Chapada Diamantina, Bahia, Brazil (Siluriformes: Heptapteridae): description, anatomy, phylogenetic relationships, natural history and biogeography
Bichuette, M.E., Rantin, B., Hingst-Zaher, E. and Trajano, E. (2015)
Geometric morphometrics throws light on evolution of the subterranean catfish Rhamdiopsis krugi (Teleostei: Siluriformes: Heptapteridae) in eastern Brazil
Trajano, E., Gallao, J.E. and Bichuette, M.E. (2016)
Spots of high biodiversity of troglobites in Brazil: the challenge of measuring subterranean diversity
Tencatt, L.F.C., dos Santos, B.F. and Bichuette, M.E. (2017)
First report of armoured catfishes Callichthyinae Bonapart, 1838 (Siluriformes: Callichthyidae) in the subterranean domain of northern and northeastern Brazil
Tencatt, L.F.C. and Bichuette, M.E. (2017)
Aspidoras mephisto, new species: The first troglobitic Callichthyidae (Teleostei: Siluriformes) from South America
Gallão, J.E. and Bichuette M.E. (2018)
Brazilian obligatory subterranean fauna and threats to the hypogean environment
Pupo, F.M. and Britto, M.R. (2018)
Comparative gross encephalon morphology in Callichthyidae (Teleostei: Ostariophysi: Siluriformes)
Pereira, E.H.L., de A. Santos, A.C., de Pinna, M.C.C. and Reis, R.E. (2019)
An enigmatic new Loricariid (Actinopterygii:Siluriformes) from relictual upper reaches of Chapada Diamantina, Bahia, Brazil
Pereira, E.H.L., de A. Santos, A.C., de Pinna, M.C.C. and Reis, R.E. (2019)
An enigmatic new Loricariid (Actinopterygii:Siluriformes) from relictual upper reaches of Chapada Diamantina, Bahia, Brazil
Tencatt, L.F.C., Muriel-Cunha, J., Zuanon, J., Ferreira, M.F.C. and Britto, M.R. (2020)
A journey through the Amazon Middle Earth reveals Aspidoras azaghal (Siluriformes: Callichthyidae), a new species of armoured catfish from the rio Xingu basin, Brazil
Tencatt, L.F.C., Britto, M.R., Isbrücker, I.J.H. and Pavanelli, C.S. (2022)
Taxonomy of the armored catfish genus Aspidoras (Siluriformes: Callichthyidae) revisited, with the description of a new species
Cardoso, G.M., Bastos-Pereira, R. and Ferreira, R.L. (2022)
Two new troglobitic species of Iansaoniscus from Brazilian caves (Crustacea, Isopoda, Pudeoniscidae)
Bichuette, M.E. (2024)
It’s time for dinner, a particular and seasonal feeding habit of a threatened troglobitic Catfish from Brazil, Rhamdiopsis krugi Bockmann and Castro 2010 (Ostaryophysi, Siluriformes)